The short version of data integrity fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-03-14 and is reviewed periodically as new material appears.
Laboratories apply HPLC testing across pharmaceutical, food, environmental, and industrial chemistry. The method can measure active ingredients, impurities, additives, preservatives, and degradation products. Sample preparation often includes dilution, filtration, and sometimes extraction or derivatization. The choice of column, mobile phase, pH, temperature, and detector depends on the analytes and matrix. Results are compared with reference standards to assign identity and concentration. Method suitability is judged by resolution, precision, and accuracy.
HPLC testing is not a single fixed procedure; it is a family of separation modes. Reversed-phase, normal-phase, ion-exchange, size-exclusion, and affinity chromatography each suit different analyte properties. Reversed-phase methods dominate because they handle many neutral and moderately polar compounds. Detection can be optical, electrochemical, or mass spectrometric, and the detector dictates what information is available. Coupling with mass spectrometry increases selectivity and enables identification when standards are unavailable. The technique cannot separate every mixture without adjustment.
HPLC testing is an analytical technique used to separate, identify, and quantify components in a liquid sample. It relies on a pressurized mobile phase that carries the sample through a column packed with stationary phase. Different compounds travel at different rates because of interactions with the stationary and mobile phases. The resulting signal versus time is a chromatogram. Peak position indicates identity under specified conditions, while peak area or height relates to amount.
Regulatory and pharmacopeial texts shape how HPLC testing is performed and documented. The International Council for Harmonisation provides validation guidance, while pharmacopeias publish general chromatography chapters and monographs for specific materials. Accreditation standards such as ISO/IEC 17025 address laboratory competence and traceability. Inspectors may review instrument qualification, analyst training, reference material control, and electronic records. Open questions include how best to validate methods for new complex products and how to handle automated data processing. Laboratories generally resolve these issues through risk assessment, method lifecycle management, and documented scientific justification.
In quality control laboratories, HPLC testing supports batch release, raw material checks, stability studies, and impurity profiling. A validated method defines sample preparation, instrument settings, calibration, and acceptance criteria. Analysts compare results with specifications and investigate out-of-specification outcomes before a batch is approved. Documentation includes chromatograms, integration records, audit trails, and reagent details. Because results influence product decisions, laboratories follow formal quality systems and data integrity rules. The exact tests and limits depend on the material, its intended use, and the applicable regulatory framework.
| Property | Value | Notes |
|---|---|---|
| Abbreviation | HPLC | Also called high-performance liquid chromatography |
| Separation mechanism | Differential partitioning | Compounds distribute between mobile and stationary phases |
| Typical column chemistry | C18 (octadecylsilane) | Used in reversed-phase separations |
| Typical detector | UV-Vis or photodiode array | Mass spectrometry is common for trace and confirmatory work |
| Typical particle size | 1.8–5 µm | Smaller particles require higher pressure and can improve speed |
Reversed-phase chromatography dominates modern HPLC testing, using a nonpolar stationary phase such as chemically bonded octadecyl groups and a polar mobile phase of water mixed with organic solvent. Analytes partition between the mobile and stationary phases according to hydrophobicity. Gradient elution changes the mobile phase composition over time to separate compounds with a wide range of retention. Isocratic elution keeps the composition constant and is simpler for routine assays. Column temperature, pH, and flow rate influence selectivity, peak shape, and retention time, so these parameters are controlled during a validated method.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. A diode array detector records full spectra across a wavelength range, which helps identify co-eluting peaks. Mass spectrometry provides mass-to-charge ratios and can confirm molecular identity at low concentrations. The choice of detector depends on analyte structure, required sensitivity, and whether quantitation or identification is the goal. No single detector works for every compound, and method development often compares responses before selecting one.
Key performance measures include retention time, peak area, peak height, resolution, tailing factor, and plate count. Retention time helps identify a peak under fixed conditions, but confirmation often requires a second method or detector. Peak area and height relate to concentration through calibration curves, which may be linear or nonlinear depending on the detector response. Resolution describes separation between adjacent peaks, while tailing factor and plate count describe peak shape and column efficiency. Performance checks verify these values before and during a run to confirm that the instrument is performing within limits.
High-performance liquid chromatography testing separates components of a liquid sample by forcing a mobile phase through a packed column. The stationary phase inside the column interacts with analytes to different degrees, so each compound exits at a characteristic retention time. A pump delivers solvent at controlled flow and pressure, while an injector introduces a precise sample volume. Detectors such as ultraviolet-visible, fluorescence, refractive index, or mass spectrometric instruments record the separated bands. The resulting chromatogram provides qualitative and quantitative information about the mixture.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Typical checks include retention time, peak area precision, resolution between critical pairs, tailing factor, and theoretical plate count. Acceptance criteria are set in the method or pharmacopeial monograph. If a suitability check fails, the run may be rejected and the instrument or sample preparation may need investigation. This practice helps prevent release of data from a system that has drifted out of control.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Feoktist I. Bogoyavlenskiy (1933–1935) Vasiliy V. Evlampiev (1935–1939) Faizi F. Faizyllin (1958–1960) Boris A. Arbuzov (1941–1950) Arkadiy N. Pudovik (1950–1958) Faizi F. Faizyllin (1958–1960) Vera F. Toropova (1960–1965) Alexander I. Kostromin (1965–1968) Alexander I. Konovalov (1968–1972) Irina V. Konovalova (1972–1987) Galina A. Chmutova (1987–1992) Nikolai A. Ulakhovich (1992–2000) Vladimir I. Galkin (since 2000– until present) Department of Analytical Chemistry Department of High Molecular and Organoelement Compounds Department of Inorganic Chemistry Department of Organic Chemistry Department of Physical Chemistry Department of Chemical Education Department of Environmental Chemistry Department of Applied Chemistry Department of Stereochemistry Division for Analytical Chemistry Division for Inorganic Chemistry and Coordination chemistry Division for Organic Chemistry Division for Physical Chemistry Division for Organoelement Compounds Division for Stereochemistry Division for Applied Chemistry Division for Environmental Chemistry
Modern definitions are concerned with the fundamental chemical reactions common to all acids. Most acids encountered in everyday life are aqueous solutions, or can be dissolved in water, so the Arrhenius and Brønsted–Lowry definitions are the most relevant. The Brønsted–Lowry definition is the most widely used definition; unless otherwise specified, acid–base reactions are assumed to involve the transfer of a proton (H+) from an acid to a base. Hydronium ions are acids according to all three definitions. Although alcohols and amines can be Brønsted–Lowry acids, they can also function as Lewis bases due to the lone pairs of electrons on their oxygen and nitrogen atoms.
The Bergmann degradation is a series of chemical reactions designed to remove a single amino acid from the carboxylic acid (C-terminal) end of a peptide. First demonstrated by Max Bergmann in 1934, it is a rarely used method for sequencing peptides. The later developed Edman degradation is an improvement upon the Bergmann degradation, instead cleaving the N-terminal amino acid of peptides to produce a hydantoin containing the desired amino acid. The Bergmann degradation follows the earlier work of Bergmann and his close colleague Leonidas Zervas, combining the organic azide degradation of the Curtius rearrangement with the Bergmann-Zervas carbobenzoxy method, which they designed to occur under relatively mild conditions so as to allow peptide sequencing. A single round of the Bergmann degradation yields an aldehyde containing the sought after amino acid residue and the remaining fragment of the original peptide in amide form.
Antimicrobial peptides are produced by species across the tree of life, including: bacteria (e.g. bacteriocin, and many others) fungi (e.g. peptaibols, plectasin, and many others) cnidaria (e.g. hydramacin, aurelin) many from insects and arthropods (e.g. cecropin, attacin, melittin, mastoparan, drosomycin, thioester-containing protein 1) amphibia, frogs (magainin, dermaseptin, aurein, and others) birds (e.g. avian defensins) and mammals (e.g. cathelicidins, alpha- and beta-defensins, regIII peptides) Research has increased in recent years to develop artificially-engineered mimics of antimicrobial peptides such as SNAPPs, in part due to the prohibitive cost of producing naturally-derived AMPs. An example of this is the facially cationic peptide C18G, which was designed from the C-terminal domain of human platelet factor IV. Currently, the most widely used antimicrobial peptide is nisin; being the only FDA approved antimicrobial peptide, it is commonly used as an artificial preservative.
Vaginal rings are most commonly used for birth control purposes but can also be used to release compounds that treat and prevent STDs as well. The rings come in one standard size that fits most women and are made of flexible materials that contain the desired compound, whether that be hormones for birth control or other compounds for STD treatment. These substances are then slowly released over an extended period of time, typically a month. This is a convenient drug delivery method because they can easily be inserted and removed and do not prohibit intercourse. For birth control purposes, the vaginal ring is removed after 3 week and a new one is inserted a week later. Vaginal rings are also often used to treat symptoms of menopause, and these rings are replaced after a 3 month use. STD prevention and treatment through the use of vaginal rings is a newer application of such a device, but holds an advantage as a low maintenance option for women in areas with less access to regular healthcare.
Sources: en.wikipedia.org
Cells of one type may release the 5(S)-HETE that they make to nearby cells of a second type which then oxidize the 5(S)-HETE to 5-oxo-ETE. This transcellular production typically involves the limited variety of cell types that express active 5-lipoxygenase, lack HEDH activity because of their high levels of NADPH compared to NADP+ levels, and therefore accumulate 5(S)-HETE, not 5-oxo-ETE, upon stimulation. This 5(S)-ETE can leave these cells, enter various cell types that possess 5-HEDH activity along with lower NADPH to NADP+ levels, and thereby be converted to 5-oxo-ETE. Transcellular production of 5-oxo-eicosatetraenoates has been demonstrated in vitro with human neutrophils as the 5(S)-HETE producing cells and human PC-3 prostate cancer cells, platelets, and monocyte-derived dendritic cells as the oxidizing cells. It is theorized that this transcellular metabolism occurs in vivo and provides a mechanism for controlling 5-oxo-ETE production by allowing it to occur or be augmented at sites were 5-lipoxygenase-containing cells congregate with cell types possessing 5-HEDH and favorable NADPH/NADP+ ratios; such sites, it is theorized, might include those involving allergy, inflammation, oxidative stress, and rapidly growing cancers.
In the laboratory it is a common precipitant and cryoprotectant in protein crystallography. Since hexylene glycol is compatible with polar and nonpolar molecules, it competes with the solvent in a crystallography experiment causing the protein to precipitate. Hexylene glycol is so effective in protein crystallography because its amphiphilic nature and small, flexible structure allows it to bind to many different locations on a protein secondary structure including alpha helices and beta sheets. When hexylene glycol binds to these different locations, water is removed and the protein crystals anneal, which prevents ice formation during cryocrystallography techniques. Incorporation of hexylene glycol into solution has been known to improve the resolution of X-ray diffraction making protein structures easily identifiable. Additionally hexylene glycol is not a strong denaturing agent and thus does not significantly alter the structure of a protein during the crystallography procedure. Hexylene glycol is also used as a lubricant for polishing specimens in metallography. Like related diols, it forms borate esters.
Glycogenolysis and gluconeogenesis in liver. Glycogenolysis and lactate release in skeletal muscle. Contract sphincters of Gastrointestinal tract. Thickened secretions from salivary glands. Insulin and glucagon secretion from pancreas. Inhibit histamine-release from mast cells. Increase protein content of secretions from lacrimal glands. Receptor also present in cerebellum. Bronchiole dilation (targeted while treating asthma attacks) Involved in brain - immune - communication Short-acting β2 agonists (SABA) bitolterol fenoterol hexoprenaline isoprenaline (INN) or isoproterenol (USAN) levosalbutamol (INN) or levalbuterol (USAN) orciprenaline (INN) or metaproterenol (USAN) pirbuterol procaterol salbutamol (INN) or albuterol (USAN) terbutaline Long-acting β2 agonists (LABA) arformoterol (some consider it to be an ultra-LABA) bambuterol clenbuterol formoterol salmeterol Ultra-long-acting β2 agonists (ultra-LABA) carmoterol indacaterol milveterol (GSK 159797) olodaterol vilanterol (GSK 642444)
Blastula-stage cells can behave as pluripotent stem cells in many species. Pluripotent stem cells are the starting point to produce organ specific cells that can potentially aid in repair and prevention of injury and degeneration. Combining the expression of transcription factors and locational positioning of the blastula cells can lead to the development of induced functional organs and tissues. Pluripotent Xenopus cells, when used in an in vivo strategy, were able to form into functional retinas. By transplanting them to the eye field on the neural plate, and by inducing several mis-expressions of transcription factors, the cells were committed to the retinal lineage and could guide vision based behavior in the Xenopus. Polarity in embryogenesis Diploblasty Triploblasty
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The American Society for Mass Spectrometry (ASMS) is a professional association based in the United States that supports the scientific field of mass spectrometry. As of 2018, the society had approximately 10,000 members primarily from the US, but also from around the world. The society holds a large annual meeting, typically in late May or early June as well as other topical conferences and workshops. The society publishes the Journal of the American Society for Mass Spectrometry.
Proteomics permits the quantitative analysis and detection of changes to proteins or protein biomarkers. Protein biomarkers detect a variety of biological changes, such as protein-protein interactions, post-translational modifications and immunological responses. Protein biomarkers are widely used in diagnostics due to their direct involvement in cellular functions and pathways. Protein biomarkers can provide direct information about the functional state of cells and tissues, offering insights into disease mechanisms. Techniques such as mass spectrometry, immunohistochemistry, ELISA, and flow cytometry are employed to detect protein biomarkers, which can indicate protein presence and quantification. For example, in about 20% of breast cancers, the cancer cells have an overexpression of the HER2 gene, leading to more aggressive tumor growth. HER2 status can be determined using IHC and FISH. HER2-positive breast cancers are treated with targeted therapies that specifically target the HER2 protein, inhibiting the growth of cancer cells.
AnIML Core AnIML Technique Definitions Additionally, AnIML Technique Definition Documents apply constraints to the AnIML Core and are specified by the AnIML Technique Definitions. The AnIML Core consists of a set of rules defining the structure of the XML document, providing a universal container for arbitrary analytical data. AnIML Technique Definitions describe how to use the AnIML Core to record experiments of a particular scientific discipline. There is a big similarity between the mechanisms of AnIML and the AVI format. The AnIML Core defines the data container, whereas the AnIML Technique Definitions act similar to the AVI codec. It defines how the data needs to be structured and labeled. Technique Definitions are XML documents, specified by the Technique Schema. official website AnIML on GitHub
Glycogenolysis and gluconeogenesis in liver. Glycogenolysis and lactate release in skeletal muscle. Contract sphincters of Gastrointestinal tract. Thickened secretions from salivary glands. Insulin and glucagon secretion from pancreas. Inhibit histamine-release from mast cells. Increase protein content of secretions from lacrimal glands. Receptor also present in cerebellum. Bronchiole dilation (targeted while treating asthma attacks) Involved in brain - immune - communication Short-acting β2 agonists (SABA) bitolterol fenoterol hexoprenaline isoprenaline (INN) or isoproterenol (USAN) levosalbutamol (INN) or levalbuterol (USAN) orciprenaline (INN) or metaproterenol (USAN) pirbuterol procaterol salbutamol (INN) or albuterol (USAN) terbutaline Long-acting β2 agonists (LABA) arformoterol (some consider it to be an ultra-LABA) bambuterol clenbuterol formoterol salmeterol Ultra-long-acting β2 agonists (ultra-LABA) carmoterol indacaterol milveterol (GSK 159797) olodaterol vilanterol (GSK 642444)
Sources: en.wikipedia.org
It measures the presence and amount of one or more compounds in a liquid sample. Separation occurs in a column, and detection produces a signal proportional to concentration. Identification usually requires comparison with a known reference standard under the same conditions.
In most cases the sample is consumed or altered during analysis, though some detectors are non-destructive. Fractions can be collected after separation for further study. Repeated testing therefore requires additional sample.
Run times range from under a minute for fast methods to over an hour for complex separations. Sample preparation, equilibration, and data review add time. Throughput depends on instrument configuration and method requirements.
System suitability is a set of checks performed before and during an HPLC run to confirm that the instrument and method are working as expected. It may include retention time repeatability, resolution between peaks, peak symmetry, and signal intensity. Failing suitability criteria usually invalidates the run.